IMPDH2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant IMPDH2, Each

$ 1,203.84
|
Details
This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. [provided by RefSeqSequence: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Additional Information
SKU | 10292313 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB28430 |