INSL5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INSL5, Each

$ 1,148.40
|
Details
The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeqSequence: LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
Additional Information
SKU | 10288456 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22388 |