518-831-8000 sales@utechproducts.com

INSL6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant INSL6, Each

1,203.84

Details

The protein encoded by this gene contains a classical signature of the insulin superfamily and is significantly similar to relaxin and relaxin-like factor. This gene is preferentially expressed in testis. Its expression in testis is restricted to interstitial cells surrounding seminiferous tubules, which suggests a role in sperm development and fertilization. [provided by RefSeqSequence: SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD

Additional Information

SKU 10287597
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21394