518-831-8000 sales@utechproducts.com

KCNC4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNC4, Each

1,148.40

Details

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD

Additional Information

SKU 10287047
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20762