518-831-8000 sales@utechproducts.com

KCNH5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNH5, Each

1,148.40

Details:

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. This gene is not expressed in differentiating myoblasts. Alternative splicing results in three transcript variants encoding distinct isoforms. [provided by RefSeqSequence: GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS

Additional Information

SKU 10288514
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22454