518-831-8000 sales@utechproducts.com

KCNJ12, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNJ12, Each

1,148.40

Details:

This gene encodes an inwardly rectifying K channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeqSequence: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

Additional Information

SKU 10291714
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27489