518-831-8000 sales@utechproducts.com

KCNK17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KCNK17, Each

1,203.84

Details

The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS

Additional Information

SKU 10289969
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24275