518-831-8000 sales@utechproducts.com

KIRREL, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant KIRREL, Each

1,148.40

Details:

NEPH1 is a member of the nephrin-like protein family, which includes NEPH2 (MIM 607761) and NEPH3 (MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).[supplied by OMIMSequence: VTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADA

Additional Information

SKU 10288511
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22451