LACE1 Rabbit anti-Human, Mouse, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LACE1, Each

$ 1,148.40
|
Details
This gene encodes a protein with possible ATPase function. The protein contains a P-loop motif and a five-domain structure that is conserved in fly, yeast, and bacteria. Two conserved estrogen receptor binding sites are located within 2.5kb of this gene. [provided by RefSeqSequence: NGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLT
Additional Information
SKU | 10288468 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22401 |