518-831-8000 sales@utechproducts.com

LACE1 Rabbit anti-Human, Mouse, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LACE1, Each

1,148.40

Details

This gene encodes a protein with possible ATPase function. The protein contains a P-loop motif and a five-domain structure that is conserved in fly, yeast, and bacteria. Two conserved estrogen receptor binding sites are located within 2.5kb of this gene. [provided by RefSeqSequence: NGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLT

Additional Information

SKU 10288468
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22401