LAPTM4A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LAPTM4A, Each

$ 1,203.84
|
Details
This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes. [provided by RefSeqSequence: EVTHPNSMPAVNIQYEVIGNYYSSERMADN
Additional Information
SKU | 10288795 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22778 |