Laptm4a Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Laptm4a, Each
$ 1,757.70
|
|
Details:
This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes. [provided by RefSeqSequence: EVTHPNSMPAVNIQYEVIGNYYSSERMADN
Additional Information
| SKU | 10288795 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22778 |
