518-831-8000 sales@utechproducts.com

LGSN, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LGSN, Each

1,148.40

Details

This gene encodes a protein with similarity to the GS I members of the glutamine synthetase superfamily. The encoded protein is referred to as a pseudo-glutamine synthetase because it has no glutamine synthesis activity and may function as a chaperone protein. This protein is localized to the lens and may be associated with cataract disease. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI

Additional Information

SKU 10288787
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22768