518-831-8000 sales@utechproducts.com

LIPT1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LIPT1, Each

1,203.84

Details

The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing in the 5' UTR of this gene results in five transcript variants that encode the same protein. [provided by RefSeqSequence: TDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQIDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPK

Additional Information

SKU 10288841
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22829