518-831-8000 sales@utechproducts.com

LPPR5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LPPR5, Each

1,148.40

Details

The protein encoded by this gene is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeqSequence: EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT

Additional Information

SKU 10287254
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21007