LRPPRC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LRPPRC, Each

$ 1,148.40
|
Details
This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4.8 to 7.0kb which result from alternative polyadenylation have been reported for this gene. [provided by RefSeqSequence: RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT
Additional Information
SKU | 10288979 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22998 |