LSG1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LSG1, Each

$ 1,148.40
|
Details
This gene encodes a protein related to the yeast large subunit GTPase 1. The encoded protein is necessary for cell viability and may localize in the endoplasmic reticulum, nucleus and cytoplasmSequence: SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE
Additional Information
SKU | 10289111 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23151 |