518-831-8000 sales@utechproducts.com

Luzp1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Luzp1, Each

1,757.70

Details:

This gene encodes a protein that contains a leucine zipper motif. The exact function of the encoded protein is not known. In mice this gene affects neural tube closure. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: RERHTSTSNIQVGLAELTSVSNHVSSPFELSIHKHDITLQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSH

Additional Information

SKU 10288271
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22169