LYZL6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant LYZL6, Each

$ 1,203.84
|
Details
Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL6 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIMSequence: CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
Additional Information
SKU | 10287947 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB21780 |