MAFB, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MAFB, Each

$ 1,216.00
|
Details
The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. [provided by RefSeqSequence: MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
Additional Information
SKU | 10286655 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20308 |