518-831-8000 sales@utechproducts.com

MGAM, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MGAM, Each

1,148.40

Details:

This gene encodes maltase-glucoamylase, which is a brush border membrane enzyme that plays a role in the final steps of digestion of starch. The protein has two catalytic sites identical to those of sucrase-isomaltase, but the proteins are only 59% homologous. Both are members of glycosyl hydrolase family 31, which has a variety of substrate specificities. [provided by RefSeqSequence: VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP

Additional Information

SKU 10291688
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27460