MGAM, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MGAM, Each

$ 1,203.84
|
Details
This gene encodes maltase-glucoamylase, which is a brush border membrane enzyme that plays a role in the final steps of digestion of starch. The protein has two catalytic sites identical to those of sucrase-isomaltase, but the proteins are only 59% homologous. Both are members of glycosyl hydrolase family 31, which has a variety of substrate specificities. [provided by RefSeqSequence: VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
Additional Information
SKU | 10291688 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB27460 |