518-831-8000 sales@utechproducts.com

MPDU1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MPDU1, Each

1,203.84

Details

This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK

Additional Information

SKU 10287056
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20774