518-831-8000 sales@utechproducts.com

MUC17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MUC17, Each

1,213.72

Details

Membrane mucins, such as MUC17, function in epithelial cells to provide cytoprotection, maintain luminal structure, provide signal transduction, and confer antiadhesive properties upon cancer cells that lose their apical/basal polarization.[supplied by OMIMSequence: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK

Additional Information

SKU 10282385
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22573