NALCN Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NALCN, Each
$ 1,148.40
|
|
Details:
NALCN forms a voltage-independent, nonselective, noninactivating cation channel permeable to Na , K , and Ca(2 ). It is responsible for the neuronal background sodium leak conductance (Lu et al., 2007 [PubMed 17448995]).[supplied by OMIMSequence: GKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVGREHRFRNFCRVVVRARFNASKTD
Additional Information
| SKU | 10288643 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22599 |
