NARG1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NARG1, Each

$ 1,203.84
|
Details
This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeqSequence: ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
Additional Information
SKU | 10287773 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB21591 |