NCAN, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NCAN, Each
$ 1,148.40
|
|
Details:
Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIMSequence: TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
Additional Information
| SKU | 10289036 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23066 |
Loading Cart Data 