518-831-8000 sales@utechproducts.com

NDUFAF3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NDUFAF3, Each

1,190.45

Details:

This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ

Additional Information

SKU 10288875
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22870