518-831-8000 sales@utechproducts.com

NGLY1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NGLY1, Each

1,216.00

Details

This gene encodes an enzyme that catalyzes hydrolysis of an N(4)-(acetyl-beta-D-glucosaminyl) asparagine residue to N-acetyl-beta-D-glucosaminylamine and a peptide containing an aspartate residue. The encoded enzyme may play a role in the proteasome-mediated degradation of misfolded glycoproteins. Multiple transcript variants encoding different isoforms have been found for this geneSequence: ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR

Additional Information

SKU 10289038
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23068