518-831-8000 sales@utechproducts.com

NIPA1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NIPA1, Each

1,148.40

Details

This gene encodes a magnesium transporter that associates with early endosomes and the cell surface in a variety of neuronal and epithelial cells. This protein may play a role in nervous system development and maintenance. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene have been associated with autosomal dominant spastic paraplegia 6. [provided by RefSeqSequence: HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA

Additional Information

SKU 10287693
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21503