Glycerol Kinase Antibody Blocking Peptide, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each

Details

A blocking peptide from human Glycerol Kinase. Source: Synthetic Amino Acid Sequence: (Accession #: NP_976325)MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS The Glycerol Kinase Blocking Peptide is derived from Synthetic. The Glycerol Kinase Blocking Peptide has been validated for the following applications: Antibody Competition.