Wnt-3a Antibody Blocking Peptide, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each
$ 387.60
|
|
Details
A blocking peptide from mouse WNT3A. Source: Synthetic Amino Acid Sequence: (Accession #: NP_033548) IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. The Wnt-3a Blocking Peptide is derived from Synthetic. The Wnt-3a Blocking Peptide has been validated for the following applications: Antibody Competition.
Additional Information
| SKU | 10179466 |
|---|---|
| UOM | Each |
| UNSPSC | 41105906 |
| Manufacturer Part Number | NBP174183PEP |
Loading Cart Data 