ZDHHC21 Antibody Blocking Peptide, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each
$ 387.60
|
|
Details
A blocking peptide from human ZDHHC21. Source: Synthetic Amino Acid Sequence: (Accession #: NP_848661)ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. The ZDHHC21 Blocking Peptide is derived from Synthetic. The ZDHHC21 Blocking Peptide has been validated for the following applications: Antibody Competition.
Additional Information
| SKU | 10177846 |
|---|---|
| UOM | Each |
| UNSPSC | 41105906 |
| Manufacturer Part Number | NBP157049PEP |
Loading Cart Data 