518-831-8000 sales@utechproducts.com

ZDHHC21 Antibody Blocking Peptide, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each

316.83

Details:

A blocking peptide from human ZDHHC21. Source: Synthetic Amino Acid Sequence: (Accession #: NP_848661)ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. The ZDHHC21 Blocking Peptide is derived from Synthetic. The ZDHHC21 Blocking Peptide has been validated for the following applications: Antibody Competition.

Additional Information

SKU 10177846
UOM Each
UNSPSC 41105906
Manufacturer Part Number NBP157049PEP