518-831-8000 sales@utechproducts.com

NSUN5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NSUN5, Each

1,203.84

Details

This gene encodes a protein with similarity to p120 (NOL1), a 120kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeqSequence: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL

Additional Information

SKU 10287521
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21311