NSUN5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NSUN5, Each
$ 1,148.40
|
|
Details
This gene encodes a protein with similarity to p120 (NOL1), a 120kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeqSequence: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
Additional Information
| SKU | 10287521 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21311 |
