NUDT14, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NUDT14, Each

$ 1,447.10
|
Details
UDP-glucose (UDPG) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. NUDT14 is a UDPG pyrophosphatase (EC 3.6.1.45) that hydrolyzes UDPG to produce glucose 1-phosphate and UMP (Yagi et al., 2003 [PubMed 12429023]).[supplied by OMIMSequence: EAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQ
Additional Information
SKU | 10290178 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB24514 |