518-831-8000 sales@utechproducts.com

ODF3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ODF3, Each

1,203.84

Details

ODF3 is a component of sperm flagella outer dense fibers, which add stiffness, elastic recoil, and protection against shearing forces during sperm movement.[supplied by OMIMSequence: PGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTP

Additional Information

SKU 10289332
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23407