518-831-8000 sales@utechproducts.com

OTOR, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant OTOR, Each

1,203.84

Details

The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. [provided by RefSeqSequence: RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Additional Information

SKU 10287857
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21682