518-831-8000 sales@utechproducts.com

PCDH17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PCDH17, Each

1,203.84

Details

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. [provided by RefSeqSequence: VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD

Additional Information

SKU 10287999
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21840