518-831-8000 sales@utechproducts.com

PIGX, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PIGX, Each

1,148.40

Details:

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGX is a subunit of a GPI mannosyltransferase complex involved in the synthesis of the core GPI structure in the endoplasmic reticulum (ER) (Ashida et al., 2005 [PubMed 15635094]).[supplied by OMIMSequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD

Additional Information

SKU 10288372
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22284