518-831-8000 sales@utechproducts.com

PLA2G6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PLA2G6, Each

1,148.40

Details:

The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only two of them have been determined to date. [provided by RefSeqSequence: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG

Additional Information

SKU 10292277
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28391