518-831-8000 sales@utechproducts.com

PLA2R1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PLA2R1, Each

1,203.84

Details

Secretory phospholipases A2 (PLA2s) have been purified from a variety of mammalian tissues as well as from insect and snake venoms. The prototype group I PLA2, the pancreatic PLA2 (PLA2G1B; MIM 172410), is involved in digestion, smooth muscle contraction, and cell proliferation. The prototype group II PLA2, the inflammatory-type PLA2 (PLA2G2A; MIM 172411), is involved in inflammatory conditions and is upregulated by proinflammatory cytokines like tumor necrosis factor (TNF; MIM 191160) and interleukin-1 (e.g., IL1B; MIM 147720). Differential toxicity of snake venom Pla2 appears to be linked to a variety of high-affinity receptors in different organs (Ancian et al., 1995 [PubMed 7721806]).[supplied by OMIMSequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Additional Information

SKU 10292003
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28009