PLCH1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PLCH1, Each

$ 1,148.40
|
Details
PLCH1 is a member of the PLC-eta family of the phosphoinositide-specific phospholipase C (PLC) superfamily of enzymes that cleave phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to generate second messengers inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) (Hwang et al., 2005 [PubMed 15702972]).[supplied by OMIMSequence: SLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQS
Additional Information
SKU | 10288950 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22962 |