518-831-8000 sales@utechproducts.com

POLDIP3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant POLDIP3, Each

1,757.70

Details:

This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified. [provided by RefSeqSequence: SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR

Additional Information

SKU 10287396
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21164