518-831-8000 sales@utechproducts.com

PON1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PON1, Each

1,203.84

Details

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeqSequence: EVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPE

Additional Information

SKU 10292341
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28460