518-831-8000 sales@utechproducts.com

POU1F1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant POU1F1, Each

1,148.40

Details

This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE

Additional Information

SKU 10289722
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23836