PPCS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PPCS, Each

$ 1,148.40
|
Details
Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCS (EC 6.3.2.5), one of the last enzymes in this pathway, converts phosphopantothenate to phosphopantothenoylcysteine (Daugherty et al., 2002 [PubMed 11923312]).[supplied by OMIMSequence: VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY
Additional Information
SKU | 10288593 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22546 |