518-831-8000 sales@utechproducts.com

PPP1R15A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PPP1R15A, Each

1,148.40

Details

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless of p53 status, and its protein response is correlated with apoptosis following ionizing radiation. [provided by RefSeqSequence: QPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCP

Additional Information

SKU 10287499
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21284