PPRC1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PPRC1, Each

$ 1,148.40
|
Details
The protein encoded by this gene is similar to PPAR-gamma coactivator 1 (PPARGC1/PGC-1), a protein that can activate mitochondrial biogenesis in part through a direct interaction with nuclear respiratory factor 1 (NRF1). This protein has been shown to interact with NRF1. It is thought to be a functional relative of PPARGC1 that activates mitochondrial biogenesis through NRF1 in response to proliferative signals. [provided by RefSeqSequence: ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ
Additional Information
SKU | 10289237 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23299 |