QRFP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant QRFP, Each
$ 1,148.40
|
|
Details:
The P518 precursor protein can be processed into several RF (arg-phe)-amide peptides, including P518. RF-amide peptides share a common C-terminal motif and are involved in cell signaling through G protein-coupled receptors (Jiang et al., 2003 [PubMed 12714592]).[supplied by OMIMSequence: GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
Additional Information
| SKU | 10292043 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28115 |
