518-831-8000 sales@utechproducts.com

RASGRF2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RASGRF2, Each

1,148.40

Details

RAS (MIM 190020) GTPases cycle between an inactive GDP-bound state and an active GTP-bound state. Guanine-nucleotide exchange factors (GEFs), such as RASGRFs, stimulate the conversion of the GDP-bound form into the active form.[supplied by OMIMSequence: FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD

Additional Information

SKU 10287404
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21172