RASGRF2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RASGRF2, Each

$ 1,203.84
|
Details
RAS (MIM 190020) GTPases cycle between an inactive GDP-bound state and an active GTP-bound state. Guanine-nucleotide exchange factors (GEFs), such as RASGRFs, stimulate the conversion of the GDP-bound form into the active form.[supplied by OMIMSequence: FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVD
Additional Information
SKU | 10287404 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB21172 |