518-831-8000 sales@utechproducts.com

Rep15, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rep15, Each

1,757.70

Details:

REP15 is a binding partner of the RAB GTPase family member RAB15 that facilitates transferrin receptor (TFRC; MIM 190010) recycling from the endocytic recycling compartment (Strick and Elferink, 2005 [PubMed 16195351]).[supplied by OMIMSequence: FDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVLDSVKSQMVRSHLPGGKAVAQFVLETEDCVFIKELLRNCLSKKDGLREVGKVYISIL

Additional Information

SKU 10291919
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27874