REP15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant REP15, Each
$ 1,203.84
|
|
Details
REP15 is a binding partner of the RAB GTPase family member RAB15 that facilitates transferrin receptor (TFRC; MIM 190010) recycling from the endocytic recycling compartment (Strick and Elferink, 2005 [PubMed 16195351]).[supplied by OMIMSequence: FDKLEEFCNLIGEDCLGLFIIFGMPGKPKDIRGVVLDSVKSQMVRSHLPGGKAVAQFVLETEDCVFIKELLRNCLSKKDGLREVGKVYISIL
Additional Information
| SKU | 10291919 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27874 |
Loading Cart Data 