RGNEF, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RGNEF, Each

$ 1,148.40
|
Details
RGNEF is a member of the Rho guanine nucleotide exchange factor (GEF) family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP.[supplied by OMIMSequence: GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Additional Information
SKU | 10289099 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23138 |