RGNEF, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RGNEF, Each
$ 1,148.40
|
|
Details:
RGNEF is a member of the Rho guanine nucleotide exchange factor (GEF) family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP.[supplied by OMIMSequence: GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Additional Information
| SKU | 10289099 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23138 |
