RMI2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RMI2, Each

$ 1,203.84
|
Details
RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).[supplied by OMIMSequence: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Additional Information
SKU | 10289623 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23731 |